A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10230
Swiss-prot Accession number	Q9YGV6 (Sequence in FASTA format)
Description	Prolactin precursor (PRL).
Source organism	Paralichthys olivaceus (Japanese flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Paralichthyidae; Paralichthys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	211 Amino acids
Molecular weight	23340
References	1   Kim Y.T., Lee S.Y.; "Flounder prolactin."; Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	VPINDLLDRASQRSDQLHSLSTTLSQELDSHFPPIGRVIMPRPSMCHTSALQTPNDKTQALQVSESELLSLARSLLQAWADPLSALSSSAFSLPHPAQSSIFNKVREMQEHSKNLGDGLDILSGKMGEAAQALSSLPFRGNDVGQDRISKLINFHFLLSCFRRDSHKIDSFLKVLRCRAANTQPEMC
Position of mature hormone in Pre-Hormone protein	187 Residues from position (25-211)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10758
Swiss-prot Accession number	P09537 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Paralichthys olivaceus (Japanese flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Paralichthyidae; Paralichthys.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	190 Amino acids
Molecular weight	21453
References	1  PubMed abstract 2567501 2  PubMed abstract 2909523 3  PubMed abstract 8522198 4  PubMed abstract 3194207
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	QPITENQRLFSIAVGRVQYLHLVAKKLFSDFENSLQLEDQRLLNKIASKEFCHSDNFLSPIDKHETQGSSVQKLLSVSYRLIESWEFFSRFLVASFAVRTQVTSKLSELKMGLLKLIEANQDGAGGFSESSVLQLTPYGNSELFACFKKDMHKVETYLTVAKCRLFPEANCTL
Position of mature hormone in Pre-Hormone protein	173 Residues from position (18-190)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	11181
Swiss-prot Accession number	O57312 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 8 (CCK8)].
Source organism	Paralichthys olivaceus (Japanese flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Paralichthyidae; Paralichthys.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	135 Amino acids
Molecular weight	14773
References	1  PubMed abstract 11042006
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	HPISSQHLDEGQRSISTPSEALLEADTHSLGEPHLRQSRSAPQLKSLPVAEEDGDSRANLSELLARLISSRKGSVRRNSTAYSKGLSPNHRIADRDYLGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	115 Residues from position (21-135)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	11182
Swiss-prot Accession number	O57312 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 8 (CCK8)].
Source organism	Paralichthys olivaceus (Japanese flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Paralichthyidae; Paralichthys.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	135 Amino acids
Molecular weight	14773
References	1  PubMed abstract 11042006
Domain Name	Gastrin
Hormone Name	Cholecystokinin 8
Mature Hormone Sequence	DYLGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (116-123)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated